Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO)

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO) spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MERTK Knockout caski Polyclonal Cells
ARG9807 1 Million

MERTK Knockout caski Polyclonal Cells

Sign In for Pricing
View Details
Hi-PCR® Dog Probe PCR Kit
MBPCR248-50R 50 Reaction

Hi-PCR® Dog Probe PCR Kit

Sign In for Pricing
View Details
RPL18P4 CRISPRa sgRNA lentivector (set of three targets)(Human)
40945121 3x 1.0µg DNA

RPL18P4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ECHDC3 Antibody (N-term)
E45R32900G-1 100 µL

ECHDC3 Antibody (N-term)

Sign In for Pricing
View Details
Human CASP14 (Caspase 14) ELISA Kit
EH25904 96 Tests

Human CASP14 (Caspase 14) ELISA Kit

Sign In for Pricing
View Details
C11orf52 3'UTR GFP Stable Cell Line
TU052749 1.0 mL

C11orf52 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details