Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E11 (SPD11)

This Recombinant Human Speedy protein E11 (SPD11) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E11 SPDYE11

UniProt

P0DTA3

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MonoMethyl-Histone H3 (Lys79) monoclonal antibody
orb1726041-01 50 µL

MonoMethyl-Histone H3 (Lys79) monoclonal antibody

Sign In for Pricing
View Details
MonoMethyl-Histone H3 (Lys79) monoclonal antibody
orb1726041-02 100 µL

MonoMethyl-Histone H3 (Lys79) monoclonal antibody

Sign In for Pricing
View Details
PSMA7 Human Over-expression Lysate
orb1378533 20 µg

PSMA7 Human Over-expression Lysate

Sign In for Pricing
View Details
Unc13d sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4634705 3x 1.0 µg

Unc13d sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
KIT ELISA Kit (Mouse)
OKEH00204-96W 96 Well

KIT ELISA Kit (Mouse)

Sign In for Pricing
View Details
ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15) discontinued
341687-01 100 µL

ACOT12 (CACH, CACH1, STARD15, Acyl-coenzyme A thioesterase 12, Acyl-CoA thioesterase 12, Acyl-CoA thioester hydrolase 12, Cytoplasmic acetyl-CoA hydrolase 1, CACH-1, hCACH-1, START domain-containing protein 15, StARD15) discontinued

Sign In for Pricing
View Details