Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC3A2 Protein Vector (Rat) (pPB-N-His)
PV306131 500 ng

SLC3A2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MRX40 Protein Vector (Human) (pPM-C-HA)
PV101464 500 ng

MRX40 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Keratin 17 (D12E5) XP® Rabbit Monoclonal Antibody
CST 12509S 100 µL

Keratin 17 (D12E5) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CAPNS1 Adenovirus (Human)
15002051 1.0 mL

CAPNS1 Adenovirus (Human)

Sign In for Pricing
View Details
Cortactin polyclonal antibody
orb1718170-01 50 µL

Cortactin polyclonal antibody

Sign In for Pricing
View Details
Cortactin polyclonal antibody
orb1718170-02 100 µL

Cortactin polyclonal antibody

Sign In for Pricing
View Details