Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lppr1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV686192 1.0 µg DNA

Lppr1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
AKT2 (3V18) Mouse Monoclonal antibody
E28PE1124 100 µL

AKT2 (3V18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
RFXANK (NM_001278728) Human Tagged ORF Clone
RG236810 10 µg

RFXANK (NM_001278728) Human Tagged ORF Clone

Sign In for Pricing
View Details
IGHD Rabbit Polyclonal Antibody
TA384496 100 µL

IGHD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GENLISA Human Histon-H2b ELISA
KBH11759 1x 96 Well

GENLISA Human Histon-H2b ELISA

Sign In for Pricing
View Details
Zebrafish THRAA Rabbit Polyclonal Antibody (APC)
orb3130595 100 µg

Zebrafish THRAA Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details