Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511) spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]
CF813375 100 µg

HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL
BNC941199-100 1x 100 µL

SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF568 conjugate, 0.1mg/mL
BNC681365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human BECN1 (Beclin 1) ELISA Kit
E-EL-H0564-01 24 Tests

Human BECN1 (Beclin 1) ELISA Kit

Sign In for Pricing
View Details
Human BECN1 (Beclin 1) ELISA Kit
E-EL-H0564-02 48 Tests

Human BECN1 (Beclin 1) ELISA Kit

Sign In for Pricing
View Details
Human BECN1 (Beclin 1) ELISA Kit
E-EL-H0564-03 96 Tests

Human BECN1 (Beclin 1) ELISA Kit

Sign In for Pricing
View Details