Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511) spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA (FOLH1) (44-750) Mouse Monoclonal Antibody [Clone ID: GCP-05]
AM03114RP-N 100 µg

PSMA (FOLH1) (44-750) Mouse Monoclonal Antibody [Clone ID: GCP-05]

Sign In for Pricing
View Details
ULK1 Rabbit Polyclonal Antibody
TA367743 100 µL

ULK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX39A Antibody
KC-44432-01 50 μL

DDX39A Antibody

Sign In for Pricing
View Details
DDX39A Antibody
KC-44432-02 100 µL

DDX39A Antibody

Sign In for Pricing
View Details
DDX39A Antibody
KC-44432-03 1 mL

DDX39A Antibody

Sign In for Pricing
View Details
Dabigatran-13C6
TRC-D100091-5MG 5 mg

Dabigatran-13C6

Sign In for Pricing
View Details