Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511) spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Water Bath Concentrator BCON-105
BCON-105 1 Unit

Water Bath Concentrator BCON-105

Sign In for Pricing
View Details
ELL3 Rabbit polyclonal Antibody
ER61160 100 µL

ELL3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
KIAA2026 Human Gene Knockout Kit (CRISPR)
KN420620 1 Kit

KIAA2026 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2461), 0.2mg/mL
BNUB2461-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2461), 0.2mg/mL

Sign In for Pricing
View Details
Human ZNF717 activation kit by CRISPRa
GA119150 1 Kit

Human ZNF717 activation kit by CRISPRa

Sign In for Pricing
View Details
Tau (S305) Antibody
KC-16701-01 50 μL

Tau (S305) Antibody

Sign In for Pricing
View Details