Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF19 Protein Lysate (Human) with C-Ha Tag
36564031 100 µg

PHF19 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
5-Chloro-6-ethoxypyridine-3-carboxylic acid
ENB27771-01 250 mg

5-Chloro-6-ethoxypyridine-3-carboxylic acid

Sign In for Pricing
View Details
5-Chloro-6-ethoxypyridine-3-carboxylic acid
ENB27771-02 2.5 g

5-Chloro-6-ethoxypyridine-3-carboxylic acid

Sign In for Pricing
View Details
Anti-GSN/Gelsolin (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134165 100 µL

Anti-GSN/Gelsolin (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
PRL ELISA Kit (Human)
OKBB00762-96W 96 Well With Removable Strips

PRL ELISA Kit (Human)

Sign In for Pricing
View Details
NSUN5C siRNA Oligos set (Human)
32210171 3x 5 nmol

NSUN5C siRNA Oligos set (Human)

Sign In for Pricing
View Details