Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]
TA501198AM 100 µL

PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

Sign In for Pricing
View Details
Recombinant Human DPYSL3
P8744-01 50 µg

Recombinant Human DPYSL3

Sign In for Pricing
View Details
Recombinant Human DPYSL3
P8744-02 200 µg

Recombinant Human DPYSL3

Sign In for Pricing
View Details
Recombinant Human DPYSL3
P8744-03 1 mg

Recombinant Human DPYSL3

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Lipoprotein-releasing system transmembrane protein LolC (lolC), partial
MBS7060264 Inquire

Recombinant Haemophilus influenzae Lipoprotein-releasing system transmembrane protein LolC (lolC), partial

Sign In for Pricing
View Details
HIV-1 gag p24 recombinant antigen a.a 77 to a.a 436 of the HIV-1 gag region 39 kDa
MBS485158-01 0.1 mg

HIV-1 gag p24 recombinant antigen a.a 77 to a.a 436 of the HIV-1 gag region 39 kDa

Sign In for Pricing
View Details