Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jagged1/CD339 Rabbit pAb
E47R23033 100 µL

Jagged1/CD339 Rabbit pAb

Sign In for Pricing
View Details
Csn1s1 3'UTR Lenti-reporter-Luc Vector
16931086 1.0 µg

Csn1s1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human TELO2 knockout cell line
ABC-KH15275 1 Vial

Human TELO2 knockout cell line

Sign In for Pricing
View Details
Col5a1 (NM_015734) Mouse Untagged Clone
MC224965 10 µg

Col5a1 (NM_015734) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Candida glabrata Pre-rRNA-processing protein IPI3 (IPI3), partial
MBS1437619 Inquire

Recombinant Candida glabrata Pre-rRNA-processing protein IPI3 (IPI3), partial

Sign In for Pricing
View Details
Rabbit Polyclonal GliS2 Antibody [Biotin]
NBP2-41311B 0.1 mL

Rabbit Polyclonal GliS2 Antibody [Biotin]

Sign In for Pricing
View Details