Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger TRAF-type-containing protein 1 (ZTRF1)

This Recombinant Human Zinc finger TRAF-type-containing protein 1 (ZTRF1) spans the amino acid sequence from region 1-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger TRAF-type-containing protein 1; Cysteine and histidine-rich protein 1; ZFTRAF1 CYHR1 KIAA0496

UniProt

P0DTL6

Expression Region

1-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGAEEAGGGGPAAGPAGSVPAGVGVGVGAGPGAAAGQAAAAALGEAAGPGLPDEAGLAGARQLQLQEAAGDPDAPPKKRLRAAEAAEAAAAAAAAGSGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human F2RL2 shRNA (UAS) - Lentiviral human F2RL2 shRNA (UAS, iRFP) plasmid
GTR15329827 1 Vial

Lentiviral human F2RL2 shRNA (UAS) - Lentiviral human F2RL2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EMA (MUC1) (NM_001018016) Human Tagged ORF Clone Lentiviral Particle
RC221390L1V 200 µL

EMA (MUC1) (NM_001018016) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-COL10A1 antibody
STJ115252 100 µl

Anti-COL10A1 antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Factor IX Antibody (014)
NBP2-89372-100ul 100 µL

Rabbit Monoclonal Factor IX Antibody (014)

Sign In for Pricing
View Details
ARAP3 Protein Lysate (Mouse) with C-HA Tag
12241034 100 µg

ARAP3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Zpbp2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4081602 1.0 µg DNA

Zpbp2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details