Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein HRURF (HRURF)

This Recombinant Human Protein HRURF (HRURF) spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HRURF; HR upstream open reading frame protein; HRURF U2HR

UniProt

P0DUH7

Expression Region

1-34

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dydc2 activation kit by CRISPRa
GA208761 1 Kit

Mouse Dydc2 activation kit by CRISPRa

Sign In for Pricing
View Details
SPINK14 (NM_001001325) Human Over-expression Lysate
LY424139 100 µg

SPINK14 (NM_001001325) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706849 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
HMGB1 antibody
FNab10218 100 µg

HMGB1 antibody

Sign In for Pricing
View Details
Tgfb1i1 Mouse Gene Knockout Kit (CRISPR)
KN517483 1 Kit

Tgfb1i1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor B3 (EPHB3) Rabbit Polyclonal Antibody
TA366848 100 µL

Eph receptor B3 (EPHB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details