Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial cell-transforming sequence 2 oncogene-like (ECT2L), partial

This Recombinant Human Epithelial cell-transforming sequence 2 oncogene-like (ECT2L), partial spans the amino acid sequence from region 566-754. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epithelial cell-transforming sequence 2 oncogene-like; Lung-specific F-box and DH domain-containing protein; Putative guanine nucleotide exchange factor LFDH; ECT2L C6orf91 LFDH

UniProt

Q008S8

Expression Region

566-754

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KRARVVRELLQSERKYVQILEIVRDVYVAPLKAALSSNRAILSAANIQIIFCDILQILSLNRQFLDNLRDRLQEWGPAHCVGEIVTKFGSQLNTYTNFFNNYPVILKTIEKCREMIPAFRTFLKRHDKTIVTKMLSLPELLLYPSRRFEEYLNLLYAVRLHTPAEHVDRGDLTTAIDQIKKYKGYIDQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIOGAZ250X26RL-T1-LL-P2 Pipe Markers for Gases
N000474 30 Pack (30 Marker (s) x 1 Roll)

BIOGAZ250X26RL-T1-LL-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
Human RGL4 knockout cell line
ABC-KH12886 1 Vial

Human RGL4 knockout cell line

Sign In for Pricing
View Details
Pus7 siRNA Oligos set (Rat)
38213176 3x 5 nmol

Pus7 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
DC Current Meter MR-100
1091500/13A 1 Each

DC Current Meter MR-100

Sign In for Pricing
View Details
Bovine Peripherin-2 (PRPH2) ELISA Kit-Sandwich
EK2F503-01 48 Test

Bovine Peripherin-2 (PRPH2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Peripherin-2 (PRPH2) ELISA Kit-Sandwich
EK2F503-02 96 Tests

Bovine Peripherin-2 (PRPH2) ELISA Kit-Sandwich

Sign In for Pricing
View Details