Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB)

This Recombinant Human Plasminogen-like protein B (PLGB) spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF-6 Rabbit Polyclonal Antibody
ER2001-54 100 µL

eIF-6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC66A2 activation kit by CRISPRa
GA112837 1 Kit

Human SLC66A2 activation kit by CRISPRa

Sign In for Pricing
View Details
Butyl Phenyl Phosphate
TRC-B809590-500MG 500 mg

Butyl Phenyl Phosphate

Sign In for Pricing
View Details
UPK1A Polyclonal Antibody
E-AB-90477-01 60 µL

UPK1A Polyclonal Antibody

Sign In for Pricing
View Details
UPK1A Polyclonal Antibody
E-AB-90477-02 120 µL

UPK1A Polyclonal Antibody

Sign In for Pricing
View Details
UPK1A Polyclonal Antibody
E-AB-90477-03 200 µL

UPK1A Polyclonal Antibody

Sign In for Pricing
View Details