Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB)

This Recombinant Human Plasminogen-like protein B (PLGB) spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP1 (CCL2) Mouse Monoclonal Antibody [Clone ID: 2D8]
AM06749PU-N 100 µg

MCP1 (CCL2) Mouse Monoclonal Antibody [Clone ID: 2D8]

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405M Conjugate, 0.1 mg/mL
BNC051331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405M Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
DKK1 (NM_012242) Human Over-expression Lysate
LY402176 100 µg

DKK1 (NM_012242) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ARP10 (APOBEC3H) activation kit by CRISPRa
GA116115 1 Kit

Human ARP10 (APOBEC3H) activation kit by CRISPRa

Sign In for Pricing
View Details
Buccutite™ Peroxidase (HRP) Antibody Conjugation Kit *Optimized for Labeling 100 ug Protein*
5503-AAT 2 Labelings

Buccutite™ Peroxidase (HRP) Antibody Conjugation Kit *Optimized for Labeling 100 ug Protein*

Sign In for Pricing
View Details
2-Bromophenylethylamine
TRC-B683640-5G 5 g

2-Bromophenylethylamine

Sign In for Pricing
View Details