Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB)

This Recombinant Human Plasminogen-like protein B (PLGB) spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc6a Mouse Gene Knockout Kit (CRISPR)
KN519419 1 Kit

Wfdc6a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRMP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
45472151 3x 1.0 µg DNA

SRMP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Terf1 (NM_001012464) Rat Tagged ORF Clone
RR203348 10 µg

Terf1 (NM_001012464) Rat Tagged ORF Clone

Sign In for Pricing
View Details
C11orf71 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9941R-BF405 100 µL

C11orf71 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Aldolase C shRNA Plasmid (h)
sc-29668-SH 20 µg

Aldolase C shRNA Plasmid (h)

Sign In for Pricing
View Details
MRPS11 (NM_022839) Human Recombinant Protein
PROTP82912 20 µg

MRPS11 (NM_022839) Human Recombinant Protein

Sign In for Pricing
View Details