Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative sodium-coupled neutral amino acid transporter 11 (S38AB), partial

This Recombinant Human Putative sodium-coupled neutral amino acid transporter 11 (S38AB), partial spans the amino acid sequence from region 361-406. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative sodium-coupled neutral amino acid transporter 11; Solute carrier family 38 member 11; SLC38A11 AVT2

UniProt

Q08AI6

Expression Region

361-406

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBM (NM_001003938) Human Tagged Lenti ORF Clone
RC207833L3 10 µg

HBM (NM_001003938) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UNC93B1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV654689 1.0 µg DNA

UNC93B1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PARP1, phosphorylated (S274) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 650) discontinued
039669-ML650 100 µL

PARP1, phosphorylated (S274) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
F2276-0106
orb1737773-01 25 mg

F2276-0106

Sign In for Pricing
View Details
F2276-0106
orb1737773-02 50 mg

F2276-0106

Sign In for Pricing
View Details
F2276-0106
orb1737773-03 100 mg

F2276-0106

Sign In for Pricing
View Details