Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial

This Recombinant Human XK-related protein 6 (XKR6), partial spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF594 conjugate, 0.1mg/mL
BNC942481-500 1x 500 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS620982 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
GABPB2 (GABPB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D7]
TA811262BM 100 µL

GABPB2 (GABPB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D7]

Sign In for Pricing
View Details
CCDC54 (Center) Rabbit Polyclonal Antibody
AP50782PU-N 400 µL

CCDC54 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant NME2 Antibody
RC-5829-01 50 μL

Recombinant NME2 Antibody

Sign In for Pricing
View Details
Recombinant NME2 Antibody
RC-5829-02 100 µL

Recombinant NME2 Antibody

Sign In for Pricing
View Details