Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G2 (O8G2P), partial

This Recombinant Human Olfactory receptor 8G2 (O8G2P), partial spans the amino acid sequence from region 1-41. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G2; Olfactory receptor 8G4; Olfactory receptor OR11-292; Olfactory receptor TPCR120; OR8G2P OR8G2 OR8G4

UniProt

Q6IF36

Expression Region

1-41

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-NED, SE [6-NED NHS ester]
214-AAT 1 mg

6-NED, SE [6-NED NHS ester]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS503251 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details
PGA
AB0197-200 600 µg

PGA

Sign In for Pricing
View Details
Serpine1 Mouse Gene Knockout Kit (CRISPR)
KN315604 1 Kit

Serpine1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATG7 Human Gene Knockout Kit (CRISPR)
KN415079 1 Kit

ATG7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse 4921531P14Rik activation kit by CRISPRa
GA208679 1 Kit

Mouse 4921531P14Rik activation kit by CRISPRa

Sign In for Pricing
View Details