Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9)

This Recombinant Human T cell receptor gamma variable 9 (TRGV9) spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA5 CRISPR Knock Out 293T Cell Line (Human)
31572141 1x 10^6 Cells / 1.0 mL

NCOA5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Glycerol mounting medium with DAPI and DABCO
orb2652961 20 mL

Glycerol mounting medium with DAPI and DABCO

Sign In for Pricing
View Details
TRMT61A Protein Vector (Mouse) (pPB-C-His)
PV241862 500 ng

TRMT61A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Transducin-Like enhancer protein 3 (TLE3) Mouse ELISA Kit
H7582 96 Tests

Transducin-Like enhancer protein 3 (TLE3) Mouse ELISA Kit

Sign In for Pricing
View Details
PDX1 Rabbit Polyclonal Antibody (PE)
orb491184 100 µL

PDX1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yuaB (yuaB)
orb1649821-01 20 µg

Recombinant Bacillus subtilis Uncharacterized protein yuaB (yuaB)

Sign In for Pricing
View Details