Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2)

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2) spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAG-1
chm-018 5µg

LAG-1

Sign In for Pricing
View Details
W/W001/FR212-SA-210x297/1-B Safety & Regulatory Compliance Signs & Labels (Adhesive)
139193 1 Pack (1 Panel (s) x 1 Pack)

W/W001/FR212-SA-210x297/1-B Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rat Pcnx2 Pre-designed siRNA Set A
SI210170A 1 Each

Rat Pcnx2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens CPF_2407 Protein (aa 1-254)
VAng-Lsx00415-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens CPF_2407 Protein (aa 1-254)

Sign In for Pricing
View Details
CK17 Mouse Monoclonal Antibody (BF555)
orb2369424 100 µL

CK17 Mouse Monoclonal Antibody (BF555)

Sign In for Pricing
View Details
N6-Etheno-nicotinamide dinucleotide phosphate (trisodium)
HY-137593A 1 Each

N6-Etheno-nicotinamide dinucleotide phosphate (trisodium)

Sign In for Pricing
View Details