Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG)

This Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG) spans the amino acid sequence from region 1-76. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAMP-dependent protein kinase inhibitor gamma; PKI-gamma; PKIG

UniProt

Q9Y2B9

Expression Region

1-76

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATSL2 Protein Lysate (Mouse) with C-HA Tag
21340034 100 µg

GATSL2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
DBCO-NHS Ester
TRC-D194965-1MG 1 mg

DBCO-NHS Ester

Sign In for Pricing
View Details
Anti-RGS11 Antibody, Rabbit Polyclonal
MBS8107943-01 0.1 mL

Anti-RGS11 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RGS11 Antibody, Rabbit Polyclonal
MBS8107943-02 5x 0.1 mL

Anti-RGS11 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
TFEC Polyclonal Antibody
CAC13956-01 50 µg

TFEC Polyclonal Antibody

Sign In for Pricing
View Details
TFEC Polyclonal Antibody
CAC13956-02 100 µg

TFEC Polyclonal Antibody

Sign In for Pricing
View Details