Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial

This Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial spans the amino acid sequence from region 184-386. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 3 RHBDD3 C22orf3

UniProt

Q9Y3P4

Expression Region

184-386

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSD Human Gene Knockout Kit (CRISPR)
KN421887 1 Kit

PSD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans,trans-2,4-Decadienal
TRC-D210500-25ML 25 mL

trans,trans-2,4-Decadienal

Sign In for Pricing
View Details
rac Metanephrine-d3 Hydrochloride Salt
TRC-M258762-50MG 50 mg

rac Metanephrine-d3 Hydrochloride Salt

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2781-A 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
CDK6 pTyr24 Rabbit Polyclonal Antibody
AP08040PU-S 50 µL

CDK6 pTyr24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN4 (NM_001025239) Human Over-expression Lysate
LC422493 20 µg

TSPAN4 (NM_001025239) Human Over-expression Lysate

Sign In for Pricing
View Details