Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial

This Recombinant Human Transmembrane protein 265 (TM265), partial spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HS90B ELISA Kit
E103322 1 Each

Mouse HS90B ELISA Kit

Sign In for Pricing
View Details
TSPAN33 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
48593154 3x 1.0 µg DNA

TSPAN33 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PLEKHA3 Protein Vector (Human) (pPB-C-His)
PV111810 500 ng

PLEKHA3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Eng AAV siRNA Pooled Vector
19287166 1.0 µg

Eng AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Dab1 (Disabled Homolog 1) discontinued
029450 100 µL

Dab1 (Disabled Homolog 1) discontinued

Sign In for Pricing
View Details
Recombinant Human IL-2RB/CD122 (C-hFc)
BP150-50ug 50 µg

Recombinant Human IL-2RB/CD122 (C-hFc)

Sign In for Pricing
View Details