Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01)

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01) spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butyne-DOTA
BA9990-10 10 mg

Butyne-DOTA

Sign In for Pricing
View Details
Lentiviral human VN1R4 shRNA (UAS) - Lentiviral human VN1R4 shRNA (UAS, iRFP) (25)
GTR15340217 1 Vial

Lentiviral human VN1R4 shRNA (UAS) - Lentiviral human VN1R4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Nop60B Antibody
orb804885 2 mg

Nop60B Antibody

Sign In for Pricing
View Details
Onyx Ladies Safety Boot Black size 7 - PR
SAF3208 PR

Onyx Ladies Safety Boot Black size 7 - PR

Sign In for Pricing
View Details
SPAG1, NT (SPAG1, Sperm-associated antigen 1, HSD-3.8, Infertility-related sperm protein Spag-1)
042194 200 µL

SPAG1, NT (SPAG1, Sperm-associated antigen 1, HSD-3.8, Infertility-related sperm protein Spag-1)

Sign In for Pricing
View Details
Oxprenolol Hydrochloride
RM-O241600-01 10 mg

Oxprenolol Hydrochloride

Sign In for Pricing
View Details