Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein CCDC163 (CC163), partial

This Recombinant Human Transmembrane protein CCDC163 (CC163), partial spans the amino acid sequence from region 55-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein CCDC163; Coiled-coil domain-containing protein 163; coiled-coil domain containing 163 pseudogene; CCDC163 C1orf231 CCDC163P

UniProt

A0A0D9SF12

Expression Region

55-145

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GSPPQNSTAVTPAVLWEESEIMQKELKLLQYQLSQHQELLLKQLAEGRQAQVGSWKIPRGAPFLTWSPASFSSMPRVLSKRTYSFGAPKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP6 Rabbit Polyclonal Antibody
orb511871 100 µg

MAP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat 17-KS ELISA Kit
ELA-E0070r 96 Tests

Rat 17-KS ELISA Kit

Sign In for Pricing
View Details
Lentiviral human LEXM shRNA (UAS) - Lentiviral human LEXM shRNA (UAS, iRFP) plasmid
GTR15314239 1 Vial

Lentiviral human LEXM shRNA (UAS) - Lentiviral human LEXM shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human HOXB9 shRNA (UAS) - Lentiviral human HOXB9 shRNA (UAS) plasmid
GTR15124339 1 Vial

Lentiviral human HOXB9 shRNA (UAS) - Lentiviral human HOXB9 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ZNF283 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51412151 3x 1.0 µg DNA

ZNF283 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Anti-ST3GAL4 Antibody Picoband® HRP Conjugated
A05863-1-HRP 100 µg/Vial

Anti-ST3GAL4 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details