Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS)

This Recombinant Human Protein MMP24OS (MMPOS) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XBP1 Mouse Monoclonal Antibody [Clone ID: OTI3D12]
CF815377 100 µg

XBP1 Mouse Monoclonal Antibody [Clone ID: OTI3D12]

Sign In for Pricing
View Details
TMSB15A Human Gene Knockout Kit (CRISPR)
KN400632 1 Kit

TMSB15A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogenic Phosphatase Substrate Sampler Kit
#10022 1 Kit

Chromogenic Phosphatase Substrate Sampler Kit

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) (NM_001105) Human Over-expression Lysate
LC420209 20 µg

Activin Receptor Type IA (ACVR1) (NM_001105) Human Over-expression Lysate

Sign In for Pricing
View Details
Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI2A2]
CF804217 100 µg

Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI2A2]

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF740 conjugate, 0.1mg/mL
BNC741813-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details