Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS)

This Recombinant Human Protein MMP24OS (MMPOS) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPIP8 (RUNDC3A) (NM_001144825) Human Over-expression Lysate
LY428521 100 µg

RPIP8 (RUNDC3A) (NM_001144825) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPT3 Antibody
8C17006-AAT 50 µg

SEPT3 Antibody

Sign In for Pricing
View Details
5-Hydroxy Tryptophan
TRC-H975700-50MG 50 mg

5-Hydroxy Tryptophan

Sign In for Pricing
View Details
GM2A (NM_000405) Human Over-expression Lysate
LC400143 20 µg

GM2A (NM_000405) Human Over-expression Lysate

Sign In for Pricing
View Details
BG-Maleimide
12566-AAT 1 mg

BG-Maleimide

Sign In for Pricing
View Details
ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]
AM12003PU-N 100 µg

ENPP3 Mouse Monoclonal Antibody [Clone ID: NP4D6]

Sign In for Pricing
View Details