Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ArraySlide gasket for AHS24-4
aua24-4s 1 Unit

ArraySlide gasket for AHS24-4

Sign In for Pricing
View Details
SAP30BP Rabbit Polyclonal Antibody
orb576933 100 µL

SAP30BP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Anti Neuronal Nuclear AutoAntibody 1 ELISA kit
GTR10420459 96 Well

Rat Anti Neuronal Nuclear AutoAntibody 1 ELISA kit

Sign In for Pricing
View Details
SLC35D2 Protein Vector (Mouse) (pPM-C-His)
PV230645 500 ng

SLC35D2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgY (H&L) - Alexa Fluor 568
E51S3514 100 µL

Rabbit Anti-Chicken IgY (H&L) - Alexa Fluor 568

Sign In for Pricing
View Details
BET1L Human qPCR Primer Pair (AY007148)
HP222948 200 Reactions

BET1L Human qPCR Primer Pair (AY007148)

Sign In for Pricing
View Details