Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Calcineurin subunit B type 1 (PPP3R1) ELISA Kit
GTR10346120 96 Well

Rabbit Calcineurin subunit B type 1 (PPP3R1) ELISA Kit

Sign In for Pricing
View Details
Mouse Anoctamin 4 (ANO4) ELISA Kit
GTR10358382 96 Well

Mouse Anoctamin 4 (ANO4) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Semaphorin 4D/CD100 Antibody (758726) [mFluor Violet 450 SE]
FAB74701MFV450 0.1 mL

Mouse Monoclonal Semaphorin 4D/CD100 Antibody (758726) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal epithelial Sodium Channel gamma Antibody
NBP3-18256 100 µg

Rabbit Polyclonal epithelial Sodium Channel gamma Antibody

Sign In for Pricing
View Details
ACSBG2 Antibody
A46988-50UL 50 μL

ACSBG2 Antibody

Sign In for Pricing
View Details
Anti-SSX2IP Rabbit Monoclonal Antibody
MA5250-.05 50 µL

Anti-SSX2IP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details