Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd33 (NM_144790) Mouse Tagged Lenti ORF Clone
MR205024L3 10 µg

Ankrd33 (NM_144790) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RIC8B
CSB-CL889121HU 10 μg Plasmid + 200 μL Glycerol

RIC8B

Sign In for Pricing
View Details
Rrm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7512005 3x 1.0 µg

Rrm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human BRD1 knockout cell line
ABC-KH1551 1 Vial

Human BRD1 knockout cell line

Sign In for Pricing
View Details
C4orf21 Rabbit Polyclonal Antibody (Cy5.5)
orb1059306 100 µL

C4orf21 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Mouse Monoclonal Fas/TNFRSF6/CD95 Antibody (50825) [Janelia Fluor 635]
FAB326JF635 0.1 mL

Mouse Monoclonal Fas/TNFRSF6/CD95 Antibody (50825) [Janelia Fluor 635]

Sign In for Pricing
View Details