Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP)

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP) spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmeff2 (NM_019790) Mouse Tagged ORF Clone
MG205799 10 µg

Tmeff2 (NM_019790) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAB35 Rabbit Polyclonal Antibody (AP)
orb883428 100 µL

RAB35 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Rabbit Anti-LRRC19 antibody
SL12310R-01 50 µL

Rabbit Anti-LRRC19 antibody

Sign In for Pricing
View Details
Rabbit Anti-LRRC19 antibody
SL12310R-02 100 µL

Rabbit Anti-LRRC19 antibody

Sign In for Pricing
View Details
Mouse Tln1 qPCR Primer Pair
QM05506S 200 Tests

Mouse Tln1 qPCR Primer Pair

Sign In for Pricing
View Details
NAGPA (NM_016256) Human Recombinant Protein
TP318271 20 µg

NAGPA (NM_016256) Human Recombinant Protein

Sign In for Pricing
View Details