Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C20orf204 (CT204)

This Recombinant Human Uncharacterized protein C20orf204 (CT204) spans the amino acid sequence from region 24-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C20orf204 C20orf204 PRR17

UniProt

A0A1B0GTL2

Expression Region

24-189

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSPACSVPDVLRHYRAIIFEDLQAAVKWGGAGAEKTRPGSRHFHFIQKNLTRPGSSGRRGRPRASCGAQKEHSILLSISSLGRTLRGAVAGGRRGALERAAWTVAVRTEAVMRRHCRTLRQRSRRPKMRPARRRGGRRQLLLRALDAVATCWEKLFALRAPASRDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP40, YDJ1 Antibody
SMC-166S 12 µg

HSP40, YDJ1 Antibody

Sign In for Pricing
View Details
IGSF11 Rabbit Polyclonal Antibody
TA371915 100 µL

IGSF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VGLL1 Human Gene Knockout Kit (CRISPR)
KN400600 1 Kit

VGLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Doravirine
TRC-D534255-1MG 1 mg

Doravirine

Sign In for Pricing
View Details
6-Chloro L-Tryptophan
TRC-C423210-50MG 50 mg

6-Chloro L-Tryptophan

Sign In for Pricing
View Details
Vilazodone Carboxylic Acid-d4
TRC-V265012-50MG 50 mg

Vilazodone Carboxylic Acid-d4

Sign In for Pricing
View Details