Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cass4 (NM_001033538) Mouse Untagged Clone
MC220476 10 µg

Cass4 (NM_001033538) Mouse Untagged Clone

Sign In for Pricing
View Details
1-(3-Chlorophenyl)piperazine hydrochloride
MBS575245-01 50 mg

1-(3-Chlorophenyl)piperazine hydrochloride

Sign In for Pricing
View Details
1-(3-Chlorophenyl)piperazine hydrochloride
MBS575245-02 100 mg

1-(3-Chlorophenyl)piperazine hydrochloride

Sign In for Pricing
View Details
1-(3-Chlorophenyl)piperazine hydrochloride
MBS575245-03 200 mg

1-(3-Chlorophenyl)piperazine hydrochloride

Sign In for Pricing
View Details
1-(3-Chlorophenyl)piperazine hydrochloride
MBS575245-04 500 mg

1-(3-Chlorophenyl)piperazine hydrochloride

Sign In for Pricing
View Details
1-(3-Chlorophenyl)piperazine hydrochloride
MBS575245-05 5x 500 mg

1-(3-Chlorophenyl)piperazine hydrochloride

Sign In for Pricing
View Details