Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis Uncharacterized protein ydaH (ydaH)
MBS1167432 Inquire

Recombinant Bacillus subtilis Uncharacterized protein ydaH (ydaH)

Sign In for Pricing
View Details
ENaC beta Antibody, Clone 7B8: Alkaline Phosphatase
MBS808295-01 0.1 mg

ENaC beta Antibody, Clone 7B8: Alkaline Phosphatase

Sign In for Pricing
View Details
ENaC beta Antibody, Clone 7B8: Alkaline Phosphatase
MBS808295-02 5x 0.1 mg

ENaC beta Antibody, Clone 7B8: Alkaline Phosphatase

Sign In for Pricing
View Details
8 Channels electronic pipette10-300μl
FLPA8031A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

8 Channels electronic pipette10-300μl

Sign In for Pricing
View Details
AG (N) Antibody, Rabbit Polyclonal
orb1478865 100 µL

AG (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Flagellar hook-basal body complex protein FliE (fliE)
MBS1377209-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Flagellar hook-basal body complex protein FliE (fliE)

Sign In for Pricing
View Details