Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant mouse Lipocalin-2/NGAL protein
ATGP3093-500 500 µg

Recombinant mouse Lipocalin-2/NGAL protein

Sign In for Pricing
View Details
ZNF433 antibody
70R-8904 100 µL

ZNF433 antibody

Sign In for Pricing
View Details
Human ATP7b ELISA Kit (Ready to Use)
orb549944-01 48 Tests

Human ATP7b ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human ATP7b ELISA Kit (Ready to Use)
orb549944-02 96 Tests

Human ATP7b ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
S2I-201
166467 10 mg

S2I-201

Sign In for Pricing
View Details
Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (AD2) [Alexa Fluor 594]
NBP2-48480AF594 0.1 mL

Mouse Monoclonal 5'-Nucleotidase/CD73 Antibody (AD2) [Alexa Fluor 594]

Sign In for Pricing
View Details