Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptojanin 2 (SYNJ2) (NM_001178088) Human Tagged ORF Clone
RC230684 10 µg

Synaptojanin 2 (SYNJ2) (NM_001178088) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rbm45 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6295407 1.0 µg DNA

Rbm45 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)
MBS6351360-01 0.2 mL

SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)

Sign In for Pricing
View Details
SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)
MBS6351360-02 5x 0.2 mL

SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)

Sign In for Pricing
View Details
CENP-C (C-6) FITC
sc-166099 FITC 200 µg/mL

CENP-C (C-6) FITC

Sign In for Pricing
View Details
CSNK1A1 Antibody
OACA02802-50UG 50 µg

CSNK1A1 Antibody

Sign In for Pricing
View Details