Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial

This Recombinant Human Testis-expressed protein 51 (TEX51), partial spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF165 Protein Vector (Human) (pPM-C-HA)
40264021 500 ng

RNF165 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
1- (2-Amino-3-phenyl-1-oxopropyl) piperidine hydrochloride
OR13321 1 Each

1- (2-Amino-3-phenyl-1-oxopropyl) piperidine hydrochloride

Sign In for Pricing
View Details
KLF10 Polyclonal Antibody, APC-Cy7 Conjugated
bs-21776R-APC-Cy7 100 µL

KLF10 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
DCAF4L1 3'UTR Lenti-reporter-Luc Vector
17706081 1.0 µg

DCAF4L1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PTCHD2 CRISPRa sgRNA lentivector (set of three targets)(Human)
38065121 3x 1.0µg DNA

PTCHD2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ANGPTL1 Antibody
R30560 100 µg

ANGPTL1 Antibody

Sign In for Pricing
View Details