Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MARCO-like protein (MRCOL)

This Recombinant Human MARCO-like protein (MRCOL) spans the amino acid sequence from region 21-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MARCO-like protein MARCOL

UniProt

A0A1B0GUY1

Expression Region

21-285

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QISNTSVFKLEENPKPALILEEKNEANHLGGQRDSNKQGGSYTQGNPGTFRLQGQPGYFNKLEKPRHFKQGRAGVLNQPGILKNSGKSNQKGNPESSNKQENSGSSSQLGRPGISTQQGNPGSSDQQEKPGSFSQKVMVGSSSQQGKPGSSSQHGNLGSSTQKGNLGSSSLQGHLGLSSHQGKPESSGQQGKPGSSSQQGNLGTSGQQEKPGSSSQQGKPGLSSHQGKPGSSSQQGNLHLSSQQGNQGPSSKQRKPGSSSRQGNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL6 (NM_001024662) Human Over-expression Lysate
LY422528 100 µg

RPL6 (NM_001024662) Human Over-expression Lysate

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2608-01 50 μL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2608-02 100 µL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2608-03 1 mL

ELAVL4 Antibody

Sign In for Pricing
View Details
(R)-Lercanidipine Hydrochloride
TRC-L179010-5MG 5 mg

(R)-Lercanidipine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS505252 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details