Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methyl-CpG-binding domain protein 3-like 2B (MB3LB)

This Recombinant Human Methyl-CpG-binding domain protein 3-like 2B (MB3LB) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Methyl-CpG-binding domain protein 3-like 2B MBD3L2B

UniProt

A0A1B0GVZ6

Expression Region

1-204

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fatty Acid Aynthase ELISA Kit
MBS1603506-01 48 Well

Mouse Fatty Acid Aynthase ELISA Kit

Sign In for Pricing
View Details
Mouse Fatty Acid Aynthase ELISA Kit
MBS1603506-02 96 Well

Mouse Fatty Acid Aynthase ELISA Kit

Sign In for Pricing
View Details
Mouse Fatty Acid Aynthase ELISA Kit
MBS1603506-03 5x 96 Well

Mouse Fatty Acid Aynthase ELISA Kit

Sign In for Pricing
View Details
Mouse Fatty Acid Aynthase ELISA Kit
MBS1603506-04 10x 96 Well

Mouse Fatty Acid Aynthase ELISA Kit

Sign In for Pricing
View Details
FLI1 Antibody
orb757314 100 µL

FLI1 Antibody

Sign In for Pricing
View Details
Lentiviral human SFXN5 shRNA (UAS) - Lentiviral human SFXN5 shRNA (UAS, iRFP) (100)
GTR15343554 1 Vial

Lentiviral human SFXN5 shRNA (UAS) - Lentiviral human SFXN5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details