Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial

This Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine-rich and transmembrane domain-containing 2 SERTM2

UniProt

A0A1B0GWG4

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT10B Antibody
A46389-50UL 50 μL

WNT10B Antibody

Sign In for Pricing
View Details
HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) (PE)
127703-PE 100 µL

HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) (PE)

Sign In for Pricing
View Details
PRKAG3, ID (PRKAG3, AMPKG3, 5'-AMP-activated protein kinase subunit gamma-3) (AP) discontinued
040442-AP 200 µL

PRKAG3, ID (PRKAG3, AMPKG3, 5'-AMP-activated protein kinase subunit gamma-3) (AP) discontinued

Sign In for Pricing
View Details
Cyp2d2 AAV Vector (Rat) (CMV)
17399106 1 µg

Cyp2d2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
ISG15 Antibody, HRP conjugated
A43782-50UG 50 µg

ISG15 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Thermobifida fusca Cutinase Protein (His Tag)
PKSQ050088-01 10 µg

Recombinant Thermobifida fusca Cutinase Protein (His Tag)

Sign In for Pricing
View Details