Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQA2 Protein Vector (Human) (pPM-C-HA)
23434021 500 ng

HLA-DQA2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human GGT5 shRNA (UAS) - Lentiviral human GGT5 shRNA (UAS, iRFP) (100)
GTR15320178 1 Vial

Lentiviral human GGT5 shRNA (UAS) - Lentiviral human GGT5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
VEGF145 (Vascular Endothelial Growth Factor 145)
365556 200 µL

VEGF145 (Vascular Endothelial Growth Factor 145)

Sign In for Pricing
View Details
Human DHRS13 siRNA
abx914099-01 15 nmol

Human DHRS13 siRNA

Sign In for Pricing
View Details
Human DHRS13 siRNA
abx914099-02 30 nmol

Human DHRS13 siRNA

Sign In for Pricing
View Details
Human NFRKB Pre-designed siRNA Set B
SI010508B 1 Each

Human NFRKB Pre-designed siRNA Set B

Sign In for Pricing
View Details