Recombinant Human TATA-box-binding protein-associated factor 11-like protein 4 (TFKL4)
This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 4 (TFKL4) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
TATA-box-binding protein-associated factor 11-like protein 4 TAF11L4
UniProt
A0A1W2PPE2
Expression Region
1-198
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSSMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCKRIMF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E319660-500MG 500 mg
(2R,5S)-Ethyl 5-((benzyloxy)amino)piperidine-2-carboxylate-hydrochloride
Sign In for Pricing
View Details 
LC401739 20 µg
GTP binding protein era homolog (ERAL1) (NM_005702) Human Over-expression Lysate
Sign In for Pricing
View Details