Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 9 TAF11L9

UniProt

A0A1W2PR64

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCRRIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP4E1 rabbit pAb
E44H15302 100 µL

AP4E1 rabbit pAb

Sign In for Pricing
View Details
Pkdcc AAV siRNA Pooled Vector
36875164 1.0 µg

Pkdcc AAV siRNA Pooled Vector

Sign In for Pricing
View Details
pECMV-Lhx8-m-FLAG Plasmid
PVT14949 2 µg

pECMV-Lhx8-m-FLAG Plasmid

Sign In for Pricing
View Details
ZNF259/ZPR1 Rabbit Polyclonal Antibody (RBITC)
orb1072840 100 µL

ZNF259/ZPR1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Agpat5 (NM_026792) Mouse Tagged Lenti ORF Clone
MR205612L3 10 µg

Agpat5 (NM_026792) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CYP2A6 Protein Lysate (Human) with C-Ha Tag
17342031 100 µg

CYP2A6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details