Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein L3 (FOXL3)

This Recombinant Human Forkhead box protein L3 (FOXL3) spans the amino acid sequence from region 1-233. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Forkhead box protein L3 FOXL3

UniProt

A0A1W2PRP0

Expression Region

1-233

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLFENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPASPAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1 Monoclonal Antibody, PerCP-Cy5.5 Conjugated
bsm-33335M-PerCP-Cy5.5 100 µL

ERK1 Monoclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
SEMA4B Polyclonal Antibody, RBITC Conjugated
bs-11477R-RBITC 100 µL

SEMA4B Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Prpf40b (NM_001134583) Rat Tagged ORF Clone Lentiviral Particle
RR210208L3V 200 µL

Prpf40b (NM_001134583) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Monoclonal MUC1 Antibody (2336A) [PE]
FAB62981P 0.1 mL

Rabbit Monoclonal MUC1 Antibody (2336A) [PE]

Sign In for Pricing
View Details
BRAF antibody
MBS533489-01 0.1 mL

BRAF antibody

Sign In for Pricing
View Details
BRAF antibody
MBS533489-02 5x 0.1 mL

BRAF antibody

Sign In for Pricing
View Details