Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein PMIS2 (PMIS2), partial

This Recombinant Human Transmembrane protein PMIS2 (PMIS2), partial spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein PMIS2 PMIS2

UniProt

A0A1W2PS18

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MALKPPSATQPAPNAPATPDAPPTTGDPGASAAPGSPTTTGGPGAPAEVPQEPQEPTQTPEELAFYAPNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ELOVL2 activation kit by CRISPRa
GA110353 1 Kit

Human ELOVL2 activation kit by CRISPRa

Sign In for Pricing
View Details
SENP7 Antibody
8C0370-AAT 50 µg

SENP7 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710422 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS804109 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF740 conjugate, 0.1mg/mL
BNC741878-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTau409 Antibody
KC-44843-01 50 μL

PTau409 Antibody

Sign In for Pricing
View Details