Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 4 (SCGR4)

This Recombinant Human Small cysteine and glycine repeat-containing protein 4 (SCGR4) spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 4; Keratin-associated protein 28-4; SCYGR4 KRTAP28-4

UniProt

A0A286YEV6

Expression Region

1-105

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGGCGGRCGGGCGGGCSGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCGSCGCGYGKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf103 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-15001R-PerCP-Cy5.5 100 µL

C1orf103 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
U2AF1L4 siRNA (Mouse)
orb1836232-01 15 nmol

U2AF1L4 siRNA (Mouse)

Sign In for Pricing
View Details
U2AF1L4 siRNA (Mouse)
orb1836232-02 30 nmol

U2AF1L4 siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Lca5l shRNA (UAS) - Lentiviral mouse Lca5l shRNA (UAS, iRFP) plasmid
GTR15126064 1 Vial

Lentiviral mouse Lca5l shRNA (UAS) - Lentiviral mouse Lca5l shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Neuropilin-2 NRP2 Rabbit Polyclonal Antibody (HRP)
orb2577199 100 µg

Neuropilin-2 NRP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-Human SH3YL1 Antibody (SAA1881)
RHN04601 100 μg

Anti-Human SH3YL1 Antibody (SAA1881)

Sign In for Pricing
View Details