Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 7 (SCGR7)

This Recombinant Human Small cysteine and glycine repeat-containing protein 7 (SCGR7) spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 7; Keratin-associated protein 28-7; SCYGR7 KRTAP28-7

UniProt

A0A286YF01

Expression Region

1-96

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCGSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Properdin, Recombinant, Mouse, aa23-464, His-Tag, Myc-Tag
585923-01 20 µg

Properdin, Recombinant, Mouse, aa23-464, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Properdin, Recombinant, Mouse, aa23-464, His-Tag, Myc-Tag
585923-02 100 µg

Properdin, Recombinant, Mouse, aa23-464, His-Tag, Myc-Tag

Sign In for Pricing
View Details
p39 (CDK5R2) (NM_003936) Human Tagged ORF Clone
RG205329 10 µg

p39 (CDK5R2) (NM_003936) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Complement Component 9 (C9) ELISA Kit
abx573225 96 Well

Human Complement Component 9 (C9) ELISA Kit

Sign In for Pricing
View Details
iVDye 1Kb DNA Ladder
V1003-025 250 µL

iVDye 1Kb DNA Ladder

Sign In for Pricing
View Details
CDK3 Rabbit Polyclonal Antibody
orb10357-01 50 μL

CDK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details