Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 44 (SMI44), partial

This Recombinant Human Small integral membrane protein 44 (SMI44), partial spans the amino acid sequence from region 57-149. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 44 SMIM44

UniProt

A0A286YF18

Expression Region

57-149

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HLIKDLAHDLADWAFGPKPDQEAAPRELRPSLTGEDLEGLDLQLALAWQGEEDAGGGGEGAPSEPPPPPEPRRPSIAFKDPPSRSSFWKLMAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMA5 (NM_021036) Human Recombinant Protein
TP761254 50 µg

SMA5 (NM_021036) Human Recombinant Protein

Sign In for Pricing
View Details
Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF405S conjugate, 0.1mg/mL
BNC042483-500 1x 500 µL

Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GF-1 Fungus DNA Extraction Kit (Proteinase K included), 50 preps
GF-FU-050 50 Preparations

GF-1 Fungus DNA Extraction Kit (Proteinase K included), 50 preps

Sign In for Pricing
View Details
Apalutamide Aminocarbonyl
TRC-A726225-25MG 25 mg

Apalutamide Aminocarbonyl

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human NCAM1 Protein (ECD, His Tag)
PKSH031994 100 µg

Recombinant Human NCAM1 Protein (ECD, His Tag)

Sign In for Pricing
View Details