Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 6 (SCGR6)

This Recombinant Human Small cysteine and glycine repeat-containing protein 6 (SCGR6) spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 6; Keratin-associated protein 28-6; SCYGR6 KRTAP28-6

UniProt

A0A286YF77

Expression Region

1-105

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGGCGGCGGGCSGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCHSCGCGCGCGKGCCQQKGCCQQKGCCKKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NMU receptor 1 (NMUR1) control/blocking peptide # 2
NMUR12-P 100 µg

Human NMU receptor 1 (NMUR1) control/blocking peptide # 2

Sign In for Pricing
View Details
COA3 Antibody
orb1259882 100 µL

COA3 Antibody

Sign In for Pricing
View Details
Gag-pol Antibody
orb843515 2 mg

Gag-pol Antibody

Sign In for Pricing
View Details
PRAMEF19 Rabbit Polyclonal Antibody (Biotin)
orb2084476 100 µL

PRAMEF19 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SGMS2 Recombinant Protein (Rat)
RP228476 100 µg

SGMS2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Lentiviral human TLX2 shRNA (UAS) - Lentiviral human TLX2 shRNA (UAS, iRFP) plasmid
GTR15090952 1 Vial

Lentiviral human TLX2 shRNA (UAS) - Lentiviral human TLX2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details